After sequencing a piece of DNA, one of the first tasks is to investigate the nucleotide content in the sequence. Starting with a DNA sequence, this example uses sequence statistics functions to determine mono-, di-, and trinucleotide content, and to locate open reading frames.
The following procedure illustrates how to use the MATLAB® Help browser to search the Web for information. In this example you are interested in studying the human mitochondrial genome. While many genes that code for mitochondrial proteins are found in the cell nucleus, the mitochondrial has genes that code for proteins used to produce energy.
First research information about the human mitochondria and find the nucleotide sequence for the genome. Next, look at the nucleotide content for the entire sequence. And finally, determine open reading frames and extract specific gene sequences.
Use the MATLAB Help browser to explore the Web. In the MATLAB Command Window, type
web('http://www.ncbi.nlm.nih.gov/')
A separate browser window opens with the home page for the NCBI Web site.
Search the NCBI Web site for information. For example,
to search for the human mitochondrion genome, from the Search list,
select Genome , and in the Search list,
enter mitochondrion homo sapiens.

The NCBI Web search returns a list of links to relevant pages.

Select a result page. For example, click the link labeled NC_012920.
The MATLAB Help browser displays the NCBI page for the human mitochondrial genome.

The following procedure illustrates how to find a nucleotide sequence in a public database and read the sequence information into the MATLAB environment. Many public databases for nucleotide sequences are accessible from the Web. The MATLAB Command Window provides an integrated environment for bringing sequence information into the MATLAB environment.
The consensus sequence for the human mitochondrial genome has
the GenBank® accession number NC_012920. Since
the whole GenBank entry is quite large and you might only be
interested in the sequence, you can get just the sequence information.
Get sequence information from a Web database. For example, to retrieve sequence information for the human mitochondrial genome, in the MATLAB Command Window, type
mitochondria = getgenbank('NC_012920','SequenceOnly',true)
The getgenbank function retrieves the nucleotide
sequence from the GenBank database and creates a character array.
mitochondria = GATCACAGGTCTATCACCCTATTAACCACTCACGGGAGCTCTCCATGCAT TTGGTATTTTCGTCTGGGGGGTGTGCACGCGATAGCATTGCGAGACGCTG GAGCCGGAGCACCCTATGTCGCAGTATCTGTCTTTGATTCCTGCCTCATT CTATTATTTATCGCACCTACGTTCAATATTACAGGCGAACATACCTACTA AAGT . . .
If you don't have a Web connection, you can load the data from a MAT file included with the Bioinformatics Toolbox™ software, using the command
load mitochondria
The load function loads the sequence mitochondria into
the MATLAB Workspace.
Get information about the sequence. Type
whos mitochondria
Information about the size of the sequence displays in the MATLAB Command Window.
Name Size Bytes Class Attributes mitochondria 1x16569 33138 char
The following procedure illustrates how to determine the monomers and dimers, and then visualize data in graphs and bar plots. Sections of a DNA sequence with a high percent of A+T nucleotides usually indicate intergenic parts of the sequence, while low A+T and higher G+C nucleotide percentages indicate possible genes. Many times high CG dinucleotide content is located before a gene.
After you read a sequence into the MATLAB environment, you can use the sequence statistics functions to determine if your sequence has the characteristics of a protein-coding region. This procedure uses the human mitochondrial genome as an example. See Reading Sequence Information from the Web.
Plot monomer densities and combined monomer densities in a graph. In the MATLAB Command Window, type
ntdensity(mitochondria)
This graph shows that the genome is A+T rich.

Count the nucleotides using the basecount function.
basecount(mitochondria)
A list of nucleotide counts is shown for the 5'-3' strand.
ans =
A: 5124
C: 5181
G: 2169
T: 4094
Count the nucleotides in the reverse complement of
a sequence using the seqrcomplement function.
basecount(seqrcomplement(mitochondria))
As expected, the nucleotide counts on the reverse complement strand are complementary to the 5'-3' strand.
ans =
A: 4094
C: 2169
G: 5181
T: 5124
Use the function basecount with
the chart option to visualize the nucleotide distribution.
figure basecount(mitochondria,'chart','pie');
A pie chart displays in the MATLAB Figure window.

Count the dimers in a sequence and display the information in a bar chart.
figure dimercount(mitochondria,'chart','bar')
ans =
AA: 1604
AC: 1495
AG: 795
AT: 1230
CA: 1534
CC: 1771
CG: 435
CT: 1440
GA: 613
GC: 711
GG: 425
GT: 419
TA: 1373
TC: 1204
TG: 513
TT: 1004
The following procedure illustrates how to look at codons for the six reading frames. Trinucleotides (codon) code for an amino acid, and there are 64 possible codons in a nucleotide sequence. Knowing the percent of codons in your sequence can be helpful when you are comparing with tables for expected codon usage.
After you read a sequence into the MATLAB environment, you can analyze the sequence for codon composition. This procedure uses the human mitochondria genome as an example. See Reading Sequence Information from the Web.
Count codons in a nucleotide sequence. In the MATLAB Command Window, type
codoncount(mitochondria)
The codon counts for the first reading frame displays.
AAA - 167 AAC - 171 AAG - 71 AAT - 130 ACA - 137 ACC - 191 ACG - 42 ACT - 153 AGA - 59 AGC - 87 AGG - 51 AGT - 54 ATA - 126 ATC - 131 ATG - 55 ATT - 113 CAA - 146 CAC - 145 CAG - 68 CAT - 148 CCA - 141 CCC - 205 CCG - 49 CCT - 173 CGA - 40 CGC - 54 CGG - 29 CGT - 27 CTA - 175 CTC - 142 CTG - 74 CTT - 101 GAA - 67 GAC - 53 GAG - 49 GAT - 35 GCA - 81 GCC - 101 GCG - 16 GCT - 59 GGA - 36 GGC - 47 GGG - 23 GGT - 28 GTA - 43 GTC - 26 GTG - 18 GTT - 41 TAA - 157 TAC - 118 TAG - 94 TAT - 107 TCA - 125 TCC - 116 TCG - 37 TCT - 103 TGA - 64 TGC - 40 TGG - 29 TGT - 26 TTA - 96 TTC - 107 TTG - 47 TTT - 78
Count the codons in all six reading frames and plot the results in heat maps.
for frame = 1:3
figure
subplot(2,1,1);
codoncount(mitochondria,'frame',frame,'figure',true,...
'geneticcode','Vertebrate Mitochondrial');
title(sprintf('Codons for frame %d',frame));
subplot(2,1,2);
codoncount(mitochondria,'reverse',true,'frame',frame,...
'figure',true,'geneticcode','Vertebrate Mitochondrial');
title(sprintf('Codons for reverse frame %d',frame));
end
Heat maps display all 64 codons in the 6 reading frames.



The following procedure illustrates how to locate the open reading frames using a specific genetic code. Determining the protein-coding sequence for a eukaryotic gene can be a difficult task because introns (noncoding sections) are mixed with exons. However, prokaryotic genes generally do not have introns and mRNA sequences have the introns removed. Identifying the start and stop codons for translation determines the protein-coding section, or open reading frame (ORF), in a sequence. Once you know the ORF for a gene or mRNA, you can translate a nucleotide sequence to its corresponding amino acid sequence.
After you read a sequence into the MATLAB environment, you can analyze the sequence for open reading frames. This procedure uses the human mitochondria genome as an example. See Reading Sequence Information from the Web.
Display open reading frames (ORFs) in a nucleotide sequence. In the MATLAB Command Window, type:
seqshoworfs(mitochondria);
If you compare this output to the genes shown on the NCBI page for
NC_012920, there are fewer genes than expected. This
is because vertebrate mitochondria use a genetic code slightly different
from the standard genetic code. For a list of genetic codes, see the
Genetic Code table in the aa2nt reference page.
Display ORFs using the Vertebrate Mitochondrial code.
orfs= seqshoworfs(mitochondria,...
'GeneticCode','Vertebrate Mitochondrial',...
'alternativestart',true);
Notice that there are now two large ORFs on the third reading frame. One starts at position 4470 and the other starts at 5904. These correspond to the genes ND2 (NADH dehydrogenase subunit 2 [Homo sapiens] ) and COX1 (cytochrome c oxidase subunit I) genes.
Find the corresponding stop codon. The start and stop
positions for ORFs have the same indices as the start positions in
the fields Start and Stop.
ND2Start = 4470; StartIndex = find(orfs(3).Start == ND2Start) ND2Stop = orfs(3).Stop(StartIndex)
The stop position displays.
ND2Stop =
5511Using the sequence indices for the start and stop of the gene, extract the subsequence from the sequence.
ND2Seq = mitochondria(ND2Start:ND2Stop)
The subsequence (protein-coding region) is stored in ND2Seq and
displayed on the screen.
attaatcccctggcccaacccgtcatctactctaccatctttgcaggcac actcatcacagcgctaagctcgcactgattttttacctgagtaggcctag aaataaacatgctagcttttattccagttctaaccaaaaaaataaaccct cgttccacagaagctgccatcaagtatttcctcacgcaagcaaccgcatc cataatccttc . . .
Determine the codon distribution.
codoncount (ND2Seq)
The codon count shows a high amount of ACC, ATA, CTA,
and ATC.
AAA - 10 AAC - 14 AAG - 2 AAT - 6 ACA - 11 ACC - 24 ACG - 3 ACT - 5 AGA - 0 AGC - 4 AGG - 0 AGT - 1 ATA - 23 ATC - 24 ATG - 1 ATT - 8 CAA - 8 CAC - 3 CAG - 2 CAT - 1 CCA - 4 CCC - 12 CCG - 2 CCT - 5 CGA - 0 CGC - 3 CGG - 0 CGT - 1 CTA - 26 CTC - 18 CTG - 4 CTT - 7 GAA - 5 GAC - 0 GAG - 1 GAT - 0 GCA - 8 GCC - 7 GCG - 1 GCT - 4 GGA - 5 GGC - 7 GGG - 0 GGT - 1 GTA - 3 GTC - 2 GTG - 0 GTT - 3 TAA - 0 TAC - 8 TAG - 0 TAT - 2 TCA - 7 TCC - 11 TCG - 1 TCT - 4 TGA - 10 TGC - 0 TGG - 1 TGT - 0 TTA - 8 TTC - 7 TTG - 1 TTT - 8
Look up the amino acids for codons ATA, CTA, ACC,
and ATC.
aminolookup('code',nt2aa('ATA'))
aminolookup('code',nt2aa('CTA'))
aminolookup('code',nt2aa('ACC'))
aminolookup('code',nt2aa('ATC'))
The following displays:
Ile isoleucine Leu leucine Thr threonine Ile isoleucine
The following procedure illustrates how to extract the protein-coding sequence from a gene sequence and convert it to the amino acid sequence for the protein. Determining the relative amino acid composition of a protein will give you a characteristic profile for the protein. Often, this profile is enough information to identify a protein. Using the amino acid composition, atomic composition, and molecular weight, you can also search public databases for similar proteins.
After you locate an open reading frame (ORF) in a gene, you can convert it to an amino sequence and determine its amino acid composition. This procedure uses the human mitochondria genome as an example. See Open Reading Frames.
Convert a nucleotide sequence to an amino acid sequence. In this example, only the protein-coding sequence between the start and stop codons is converted.
ND2AASeq = nt2aa(ND2Seq,'geneticcode',...
'Vertebrate Mitochondrial')
The sequence is converted using the Vertebrate Mitochondrial genetic
code. Because the property AlternativeStartCodons is
set to 'true' by default, the first codon att is
converted to M instead of I.
MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVLTKKMNP RSTEAAIKYFLTQATASMILLMAILFNNMLSGQWTMTNTTNQYSSLMIMM AMAMKLGMAPFHFWVPEVTQGTPLTSGLLLLTWQKLAPISIMYQISPSLN VSLLLTLSILSIMAGSWGGLNQTQLRKILAYSSITHMGWMMAVLPYNPNM TILNLTIYIILTTTAFLLLNLNSSTTTLLLSRTWNKLTWLTPLIPSTLLS LGGLPPLTGFLPKWAIIEEFTKNNSLIIPTIMATITLLNLYFYLRLIYST SITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTTLLLPISPFMLMIL
Compare your conversion with the published conversion in the GenPept database.
ND2protein = getgenpept('YP_003024027','sequenceonly',true)
The getgenpept function retrieves the published
conversion from the NCBI database and reads it into the MATLAB Workspace.
Count the amino acids in the protein sequence.
aacount(ND2AASeq, 'chart','bar')
A bar graph displays. Notice the high content for leucine, threonine and isoleucine, and also notice the lack of cysteine and aspartic acid.

Determine the atomic composition and molecular weight of the protein.
atomiccomp(ND2AASeq) molweight (ND2AASeq)
The following displays in the MATLAB Workspace:
ans =
C: 1818
H: 2882
N: 420
O: 471
S: 25ans = 3.8960e+004
If this sequence was unknown, you could use this information to identify the protein by comparing it with the atomic composition of other proteins in a database.